Skip to product information
1 of 4

Peptides of London

TB500 5mg

TB500 5mg

Regular price $49.00 USD
Regular price Sale price $49.00 USD
Sale Sold out
Taxes included. Shipping calculated at checkout.

  • Product Name: TB500 5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid
  • CAS number: 77591-33-4

Reconstitute with: Bacteriostatic water


Usage and Storage

Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°c for a limited period of time. The lyophilised protein remains stable until expiry date when stored at -20°c.

 

View full details