LL37 5mg

LL-37 Peptide 10mg – Antimicrobial Research Peptide (≥99% Purity)

LL-37 is a 37-amino acid cationic antimicrobial peptide belonging to the cathelicidin family, generated via proteolytic cleavage from the human CAP18 precursor protein. Extensively studied in preclinical settings, LL-37 has become a focal point in innate immune response research, inflammatory signalling, and wound regeneration studies.

⚙️ 

Peptide Specifications

• Sequence: [LL-37, 37 aa]
• Molecular Formula: C₂₀₄H₃₄₀N₆₀O₅₁
• Molecular Weight: ~4493.3 g/mol
• Appearance: White lyophilised powder
• Purity: ≥99% (HPLC Verified)
• Solubility: Water (lab-grade) or sterile buffer solutions
• Storage: 2–8°C (short term) / –20°C (long term)
• Packaging: Sterile 10mg vial, mannitol-free

🔬 

Research Highlights

• Immunological Studies: LL-37 is widely studied for its role in modulating TLR pathways, cytokine release, and neutrophil activation in microbial resistance models.
• Antimicrobial Peptide (AMP) Research: Demonstrates broad-spectrum activity against Gram-positive and Gram-negative bacteria in controlled lab environments.
• Wound Repair Models: In animal studies, LL-37 has been investigated for its potential role in tissue regeneration and cell signalling under oxidative stress conditions.
• Synergistic Applications: Often co-studied with peptides like GHK-Cu in research targeting epithelial restoration and inflammation control.

🔒 For Research Use Only

Not for human consumption or therapeutic application.

Strictly intended for laboratory research and academic study.