Skip to product information
1 of 1

Peptides of London

LL37 5mg

LL37 5mg

Regular price £34.99 GBP
Regular price Sale price £34.99 GBP
Sale Sold out
Taxes included. Shipping calculated at checkout.

Peptide Specifications

 

 

  • Sequence: [LL-37, 37 aa]
  • Molecular Formula: C₂₀₄H₃₄₀N₆₀O₅₁
  • Molecular Weight: ~4493.3 g/mol
  • Appearance: White lyophilised powder
  • Purity: ≥99% (HPLC Verified)
  • Solubility: Water (lab-grade) or sterile buffer solutions
  • Storage: 2–8°C (short term) / –20°C (long term)
  • Packaging: Sterile 10mg vial, mannitol-free


 

 

 

🔬 

Research Highlights 

 

 

🔒 For Research Use Only

Not for human consumption or therapeutic application.

Strictly intended for laboratory research and academic study.

View full details