1
/
of
1
Peptides of London
LL37 5mg
LL37 5mg
Regular price
£69.99 GBP
Regular price
Sale price
£69.99 GBP
Unit price
/
per
Taxes included.
Shipping calculated at checkout.
Couldn't load pickup availability
LL-37 Peptide 10mg – Antimicrobial Research Peptide (≥99% Purity)
LL-37 is a 37-amino acid cationic antimicrobial peptide belonging to the cathelicidin family, generated via proteolytic cleavage from the human CAP18 precursor protein. Extensively studied in preclinical settings, LL-37 has become a focal point in innate immune response research, inflammatory signalling, and wound regeneration studies.
⚙️
Peptide Specifications
- Sequence: [LL-37, 37 aa]
- Molecular Formula: C₂₀₄H₃₄₀N₆₀O₅₁
- Molecular Weight: ~4493.3 g/mol
- Appearance: White lyophilised powder
- Purity: ≥99% (HPLC Verified)
- Solubility: Water (lab-grade) or sterile buffer solutions
- Storage: 2–8°C (short term) / –20°C (long term)
- Packaging: Sterile 10mg vial, mannitol-free
🔬
Research Highlights
- Immunological Studies: LL-37 is widely studied for its role in modulating TLR pathways, cytokine release, and neutrophil activation in microbial resistance models.
- Antimicrobial Peptide (AMP) Research: Demonstrates broad-spectrum activity against Gram-positive and Gram-negative bacteria in controlled lab environments.
- Wound Repair Models: In animal studies, LL-37 has been investigated for its potential role in tissue regeneration and cell signalling under oxidative stress conditions.
- Synergistic Applications: Often co-studied with peptides like GHK-Cu in research targeting epithelial restoration and inflammation control.
🔒 For Research Use Only
Not for human consumption or therapeutic application.
Strictly intended for laboratory research and academic study.
Share
